|
|
|
|
Vol. 56, Issue 5, 933-937, November 1999
Department of Molecular and Cellular Pharmacology, University of Miami School of Medicine, Miami, Florida
| |
Summary |
|---|
|
|
|---|
Selective ligands are needed for distinguishing the functional roles of M2 receptors in tissues containing several muscarinic receptor subtypes. Because the venom of the green mamba Dendroaspis angusticeps contains the most specific antagonists known for M1 and M4 receptors (m1-toxin and m4-toxin), it was screened for toxins that inhibit the binding of [3H]N-methylscopolamine ([3H]NMS) to cloned M2 receptors. Desalted venom had as much anti-M2 as anti-M4 activity. The most active anti-M2 toxin in the venom was isolated by gel filtration, cation-exchange chromatography, and reversed-phase HPLC, and called m2-toxin. Spectrometry yielded a mass of 7095 Da, and N-terminal sequencing of 53 amino acids showed RICHSQMSSQPPTTTFCRVNSCYRRTLRDPHDPRGT-IIVRGCGCPRMKPGTKL. This sequence is more homologous to antinicotinic than antimuscarinic toxins, but it lacks three almost invariant residues of antinicotinic toxins required for their activity. m2-Toxin fully blocked the binding of [3H]NMS and [3H]oxotremorine-M to M2 receptors with Hill coefficients near 1, and blocked 77% of the binding sites for 0.1 nM [3H]NMS in the rat brainstem (Ki = 11 nM). Concentrations that fully blocked cloned M2 receptors had no effect on M4 receptors, but slightly increased [3H]NMS binding to M1 receptors, an allosteric effect. In accord with these results, light microscopic autoradiography of the rat brain showed that m2-toxin decreased [3H]NMS binding in regions rich in M2 receptors and increased binding in regions rich in M1 receptors. Thus m2-toxin is a novel M2-selective, short-chain neurotoxin that may prove useful for binding and functional studies.
| |
Introduction |
|---|
|
|
|---|
Experiments
with subtype-selective antibodies and cDNA probes have partially mapped
the distribution of M2 muscarinic receptors in the brain and peripheral
tissues (Levey et al., 1991
; Levey, 1993
). These receptors are
prevalent in cholinergic nerves and at many postsynaptic sites. Brain
regions and tissues with relatively high concentrations include the
nuclei of the facial and trigeminal nerves; the superior and inferior
colliculi; the anteroventral nucleus of the thalamus; cardiac
muscle; and smooth muscles.
Although subtype-selective antibodies are useful for elucidating the
distribution and approximate levels of M2 receptors in tissues, they
are not useful for studies of the functional roles of M2 receptors. The
most M2-selective antagonists currently available, gallamine and AF-DX
116, show only 30- and 15-fold higher affinity for M2 than for M1
receptors (Dong et al., 1995
). Similarly, there are no truly selective
agonists for M2 receptors (Lazareno et al., 1993
). Therefore, it is
important to find new ligands for M2 receptors. Because the venom of
the east African green mamba has been shown to contain toxins that bind
with very high selectivity to M1 and M4 receptors (m1-toxin and
m4-toxin) (Max et al., 1993a
,c
; Liang et al., 1996
; Carsi and
Potter, 1999
), we screened this venom for toxins with anti-M2 activity.
This article describes the isolation and partial characterization of
the first toxin that binds with high selectivity to M2 receptors.
| |
Materials and Methods |
|---|
|
|
|---|
Materials. [N-methyl-3H]-scopolamine ([3H]NMS; 84 Ci/mmol) and [3H]-oxotremorine-M ([3H]oxo-M; 85 Ci/mmol) were obtained from Dupont-New England Nuclear Products (Boston, MA).
Venom. Lyophilized venom from the green mamba was obtained from the Miami Serpentarium (Punta Gorda, FL). To remove acetylcholine (ACh), which constitutes 2 to 3% of the venom, 0.5 g of dry venom was dissolved in 10 ml of ice-cold 30 mM ammonium acetate buffer at pH 7, and centrifuged at 27,000gmax for 15 min to remove insoluble material. The fluid was centrifuged at 3000gmax in a Centriprep-3 concentrator (Amicon/Millipore, Bedford, MA) with a molecular weight cutoff of 3000 Da until its unfiltered volume was 1 ml. This residual milliliter was diluted 10-fold with fresh buffer, and centrifugation and dilution were repeated twice to remove >99% of the ACh and other small molecules in the venom sample.
Gel Filtration of Venom Proteins.
Gel filtration was
performed using Sephadex G-50 as described previously (Max et al.,
1993a
). Fractions of the eluate were screened for anti-M2 activity,
pooled as required, and lyophilized.
Cation-Exchange Chromatography. Fractions obtained by gel filtration were reconstituted with 10 ml of 30 mM ammonium acetate buffer (pH 6.5) and applied to a 100-ml column of Bio-Rex 70 (Bio-Rad, Hercules, CA) at 4°C. Proteins were eluted with a linear gradient formed by mixing 500 ml of 0.1 M ammonium acetate and 500 ml of 1.0 M ammonium acetate (both pH 6.5). Ninety 8.0-ml fractions were collected and tested for anti-M2 activity. Fractions with anti-M2 activity were pooled and lyophilized.
Reversed-Phase HPLC. The most active anti-M2 component retained from the Bio-Rex 70 column was reconstituted in 1 ml of 15% acetonitrile in 0.1% trifluoracetic acid (TFA) and applied to a 10 × 100 mm reversed-phase column (Aquapore C18; Applied Biosystems, San Jose, CA). Proteins were eluted at 23°C with a linear gradient of 15 to 30% acetonitrile in 0.1% TFA, during 70 min, at a flow rate of 1.5 ml/min. Protein peaks were monitored at 280 nm, collected manually, and assayed for anti-M2 activity. The active peak was lyophilized, reconstituted in 1 ml of 15% acetonitrile in 0.085% TFA, and applied to an analytical C18 reversed-phase column (4.6 × 250 mm; Vydac, Separations Group, Hesperia, CA). m2-Toxin was eluted at 23°C with a linear gradient of 15 to 25% acetonitrile in 0.085% TFA, at a flow rate of 1.5 ml/min, during 90 min. Protein peaks were detected at 220 nm and tested for antimuscarinic activity, and the pure toxin was lyophilized.
Assays of the Ability of Toxins to Inhibit Binding of
[3H]NMS.
Membranes from the rat brainstem (Potter et
al., 1984
) and Chinese hamster ovary (CHO) cells containing cloned M2
receptors (Max et al., 1993a
) were prepared as described previously.
Membranes from 1 mg of cells or tissue were incubated with aliquots of
toxin and 0.1 nM [3H]NMS in 1.0 ml of 50 mM
sodium phosphate buffer containing 1.0 mM EDTA (pH 7.4)
(phosphate-EDTA buffer) for 2 h at 25°C. Membranes were
collected on glass fiber filters; the filters were dried and
radioactivity was counted at an efficiency of 49 to 51% (Potter et
al., 1984
). Inhibition curves with analyzed with a computer program
(GraphPad Prism; San Jose, CA). Cloned M2 receptors were used during
the purification of m2-toxin.
Selectivity of m2-Toxin for M1, M2, and M4 Receptors. Membranes from 1 mg of CHO cells expressing M1, M2, or M4 muscarinic receptors were incubated with aliquots of toxin and 1.0 nM [3H]NMS in 0.15 ml of phosphate-EDTA buffer for 2 h at 25°C. Membranes were collected by filtration, dried, and counted for radioactivity.
Effect of m2-Toxin on the Binding of [3H]oxo-M. Membranes from 1 mg of rat brainstem were incubated with various concentrations of m2-toxin and 5.0 nM [3H]oxo-M in 0.15 ml of 20 mM Tris buffer containing 1.0 mM MnCl2 (pH 7.4) for 90 min at 25°C. Membranes were collected by filtration and dried, and their radioactivity was counted.
Autoradiography.
The procedure was modified slightly from
Mash and Potter (1986)
. Parasagittal sections of rat brain, 18-µm
thick, were incubated on slides with 0 or 10 µg/ml of m2-toxin in
phosphate-EDTA buffer for 30 min at 25°C.
[3H]NMS was added to a concentration of 0.1 nM,
and incubation was continued for 1 h. Sections were rinsed three
times for 10 min with ice-cold buffer containing 1.0 µM
(±)-quinuclidinyl benzilate, dried, and apposed to Hyperfilm
(Amersham, Arlington Heights, IL) for 7 weeks at room temperature.
Amino Acid Sequencing. Ten micrograms of m2-toxin was sequenced by Edman degradation on a Procise liquid/gas phase sequencer (Applied Biosystems, Foster City, CA). Sequences were aligned with a computer program (DNASTAR, Madison, WI).
| |
Results |
|---|
|
|
|---|
Figure 1 shows the effect of
desalted mamba venom on the binding of [3H]NMS
to cloned M1 to M5 receptors in CHO cell membranes. It is evident that
the venom contains toxins that prevent the binding of
[3H]NMS to M1, M2, and M4 receptors, and that
there is as much anti-M2 as anti-M4 activity. Negligible anti-M3 or
anti-M5 activity was found.
|
Figure 2 shows gel filtration of crude
mamba venom on Sephadex G-50. Anti-M2 activity was prevalent in the
third protein peak, which contains monomeric toxins (Harvey et al.,
1984
). These fractions were pooled and lyophilized.
|
Figure 3 shows chromatography of the
anti-M2 material retained from the Sephadex G-50 eluate on the cation
exchange resin Bio-Rex 70. Two peaks of anti-M2 activity were obtained.
The second peak showed higher total activity and less protein and was
lyophilized.
|
Figure 4 shows reversed-phase
chromatography of the anti-M2 material retained from the previous step,
on a preparative C18 column. A single peak of anti-M2 activity was
eluted in 18% acetonitrile, pooled, lyophilized, and run again on an
analytical C18 column. By comparison, m1-toxins 1-4 and
m4-toxin elute from the same column in 25 to 27% acetonitrile (Liang
et al., 1996
; Carsi and Potter, 1999
). Examination of the purified
toxin by mass spectrometry showed a linear mass of 7095 Da
(Carsi-Gabrenas, 1997
).
|
Figure 5 shows the ability of the
purified toxin to inhibit the binding of
[3H]NMS to muscarinic receptors in membranes
from the rat brainstem. The inhibition curve had a Hill coefficient
close to 1.0, indicating that the toxin excludes NMS from M2 receptors.
The calculated Ki was 11 nM, assuming a
toxin mass of 7095 Da and a Kd of 0.125 nM
for [3H]NMS under the conditions used (Potter
et al., 1991
). The toxin blocked 77% of the total
[3H]NMS sites, in accord with evidence that 70 to 84% of brainstem muscarinic receptors precipitate with M2-selective
antibodies (Levey, 1993
).
|
The selectivity of the toxin for M2 muscarinic receptors was tested on
CHO cells expressing cloned human M1, M2, and M4 receptors (Fig.
6). The toxin inhibited the binding of
[3H]NMS only to M2 receptors, and therefore was
named m2-toxin. However, concentrations sufficient to fully inhibit
[3H]NMS binding to M2 receptors slightly
increased binding to M1 receptors. Receptors of the M3 and M5 subtypes
were not tested, because they were unaffected by desalted venom.
|
The ability of m2-toxin to block the binding of
[3H]NMS was examined further by light
microscopic autoradiography (Fig. 7). In
the presence of m2-toxin, there was a marked decrease of
[3H]NMS binding in regions of the rat brain
that show high levels of M2 receptors, including the trigeminal and
facial motor nuclei, the superior and inferior colliculi, and pontine
nuclei. At the same time, [3H]NMS binding was
enhanced in the cortex, striatum, and hippocampus, where M1 receptors
are known to be prevalent.
|
The effect of m2-toxin on the binding of
[3H]oxo-M to M2 receptors is shown in Fig.
8. The toxin inhibited the binding of
this agonist with an IC50 of 7.3 µg/ml. This
corresponds to a Ki of 231 nM, assuming a
mass of 7095 Da for the toxin and a Kd of
1.45 nM for [3H]oxo-M under the conditions used
(Potter et al., 1991
).
|
A partial amino acid sequence for m2-toxin is shown in Fig.
9, and is compared with the sequence of
erabutoxin b, a well studied antinicotinic toxin that has a compact
core containing four disulfide bonds and three loops (Pillet et al.,
1993
; Ménez, 1998
). m2-Toxin clearly has the structure of a
curaremimetic toxin. The initial 53 amino acids of m2-toxin are
identical with those of a toxin predicted from a cDNA cloned from the
venom glands of the green mamba (gm60; A. Trinidad, W. Strauss, and
L. T. Potter, unpublished observations). The calculated mass of
gm60 is 7092 Da, assuming four disulfide bonds, a value very similar to
the linear mass of m2-toxin (7095). Figure 9 also includes a comparison
of m2-toxin/gm60 with five other toxins that bind to muscarinic
receptors.
|
| |
Discussion |
|---|
|
|
|---|
m2-Toxin is the first toxin that has been shown to distinguish M2
receptors from other muscarinic receptors, and it is the most specific
ligand known for distinguishing M2 from M1 receptors. By comparison,
gallamine binds to M2 receptors with 30-, 112-, 151-, and 363-fold
higher affinity than to M1, M4, M5, and M3 receptors, respectively
(Dong et al., 1995
).
The fact that m2-toxin increased the binding of
[3H]NMS to M1 receptors indicates that the
toxin binds to M1 receptors allosterically, much as m1-toxin binds to
M1 receptors allosterically (Max et al., 1993b
). Therefore, m1-toxin
can be expected to block the binding of m2-toxin to M1 receptors, and
both toxins may be useful whenever it is necessary to distinguish M2
from other muscarinic receptors. Because m2-toxin binds outside the
pocket of M1 receptors that holds NMS, it is likely that m2-toxin also
binds outside the corresponding pocket of M2 receptors.
m2-toxin is probably identical with gm60 (Fig. 9), because their first
53 amino acid residues are identical and their linear masses were
indistinguishable, and m1-toxin behaves like a strongly cationic
peptide during cation exchange chromatography, whereas gm60 has a
calculated pI of 9.3. The pI of gm60 is significantly higher than the
pI values for 11 other toxins that affect muscarinic receptors
(6.7-8.7 pI; Carsi and Potter, 1999
).
m2-Toxin is the first toxin that binds to muscarinic receptors that has
a sequence like that of antinicotinic toxins (Fig. 9). A search of
Genbank nonredundant sequences comparable with m2-toxin showed
89 toxins with 59 to 83 residues, almost all of which are
antinicotinic. The closest relative showed 60% identity and 67%
homology. Antinicotinic toxins have six very highly conserved residues
that are important for their functional activity: K-27, W-29, D-31,
R-33, E-38, and K-47 (numbered as in erabutoxin b; Ménez, 1998
).
Because m2-toxin lacks residues corresponding to K-27, W-29, and E-38,
it is not likely to have substantial antinicotinic activity.
Although m2-toxin is intriguing because of its similarity to
antinicotinic toxins, it probably will prove more important for clues
as to the structural features of antimuscarinic toxins that account for
their binding selectivity. Figures 9 and
10 compare the sequences of six toxins
that bind to M1 to M5 receptors. Fifteen residues are identical,
including a strongly basic residue (R-34) near the tip of the center
loop; P-33 also is identical in all but MT
. Most of these
residues are common among all short-chain neurotoxins. The diversity
among the toxins that bind to M1 to M5 receptors is in their loops.
m2-Toxin is distinctive for its long center loop, and it has a number
of nonconserved residues in each loop. H-31 is of particular interest.
Jolkkonen (1996)
noted that MT
and MT4 are identical except
for residues 31 to 33 (LNH versus IVP), yet only MT
binds with high
affinity to M3 to M5 receptors. Therefore, residues 31 to 33 must
confer the different specificities of these two toxins, and the
corresponding HDP (and especially the H-31) of m2-toxin may help confer
its M2-selectivity. We are expressing mutant forms of m1-toxin with residues 31 to 33 characteristic of the other subtype-selective toxins
to test the idea that this region is important for binding specificity
(Krajewski et al., 1999
).
|
Antinicotinic toxins labeled with radioiodine have proved extremely
useful for quantitative studies of nicotinic receptors (since Miledi
and Potter, 1971
); thus, experiments with
125I-labeled m2-toxin are planned. It may be
noted that radioactive gallamine has not been available for binding
studies; thus, a labeled M2-selective antagonist would be very helpful
for research purposes.
As expected, m2-toxin blocked the binding of [3H]oxo-M to M2 receptors, but the Kd for blocking the binding of this agonist was 20-fold higher than the corresponding Kd for [3H]NMS (231 versus 11 nM). Some of the difference may arise from the different buffers used; however, we suspect that different allosteric effects in toxin-antagonist-receptor and toxin-agonist-receptor complexes also may be important. More accurate affinity data without allosteric effects can be expected from direct measurements with 125I-labeled m2-toxin. In preliminary studies, 30 nM m2-toxin had no effect on the rate of beating of isolated rat atria during exposure at room temperature for 5 min or the ability of 1.0 µM carbachol to reduce the resting rate by 80 to 100%. This is a long incubation time for a short-chain neurotoxin, which should diffuse well in tissues; thus, we do not understand why there was no effect of the toxin. Higher concentrations of m2-toxin probably are required to establish whether it is an agonist or antagonist, and we have not had enough toxin to perform these studies. In fact, the amounts of m2-toxin available from venom are so limited that useful quantities probably will need to be obtained by expressing the cDNA for m2-toxin or by direct peptide synthesis.
The present results showed at least one other m2-toxin in green mamba
venom. Work is in progress to see whether it has a structure like that
of m2-toxin or one like other antimuscarinic toxins. The venom did not
show significant anti-M3 or anti-M5 activity (Fig. 1). Thus far, the
only toxin that binds with high affinity to M3 and M5 receptors is
MT
(Jolkkonen et al., 1995
).
| |
Footnotes |
|---|
Received April 19, 1999; Accepted July 28, 1999
This work was supported by U.S. Public Health Service Grants AG 06170 and AG 12976.
Send reprint requests to: Lincoln T. Potter, Department of Molecular and Cellular Pharmacology, University of Miami School of Medicine, P.O. Box 016189, Miami, FL 33101. E-mail: lpotter{at}miami.edu
| |
Abbreviations |
|---|
NMS, N-methylscopolamine; oxo-M, oxotremorine-M; ACh, acetylcholine; TFA, trifluoracetic acid; CHO, Chinese hamster ovary.
| |
References |
|---|
|
|
|---|
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||